| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATF6 beta |
| Clone | 4D10 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against recombinant protein for WB. It has been used for ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATF6 beta Antibody (4D10) from Novus Biologicals is a mouse monoclonal antibody to ATF6 beta. This antibody reacts with human. The ATF6 beta Antibody (4D10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | CREBL1 (NP_004372.3, 2 a.a. - 88 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK |
| Other Names | activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta, ATF6-beta, cAMP response element-binding protein-related protein, cAMP responsive element binding protein-like 1, CREBL1CREB-RP, Creb-related protein, Creb-rp, cyclic AMP-dependent transcription factor ATF-6 beta, FLJ10066, G13cAMP-responsive element-binding protein-like 1, Protein G13 |
| Gene, Accession # | ATF6B, Gene ID: 1388, Accession: NP_004372, SwissProt: NP_004372 |
| Catalog # | H00001388-M02 |
| Price | |
| Order / More Info | ATF6 beta Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|