| Edit |   |
|---|
| Antigenic Specificity | RNF44 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF44 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF44. This antibody reacts with human. The RNF44 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RNF44(ring finger protein 44) The peptide sequence was selected from the N terminal of RNF44. Peptide sequence LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL. |
|---|
| Other Names | KIAA1100, ring finger protein 44 |
|---|
| Gene, Accession # | RNF44, Gene ID: 22838, Accession: Q7L0R7, SwissProt: Q7L0R7 |
|---|
| Catalog # | NBP1-53143-20ul |
|---|
| Price | |
|---|
| Order / More Info | RNF44 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|