| Edit |   |
|---|
| Antigenic Specificity | RNF8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF8. This antibody reacts with human. The RNF8 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RNF8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMI |
|---|
| Other Names | C3HC4-type zinc finger protein, EC 6.3.2, EC 6.3.2.-, FLJ12013, KIAA0646UBC13/UEV-interacting ring finger protein, ring finger protein (C3HC4 type) 8, ring finger protein 8E3 ubiquitin-protein ligase RNF8 |
|---|
| Gene, Accession # | RNF8, Gene ID: 9025 |
|---|
| Catalog # | NBP2-57378 |
|---|
| Price | |
|---|
| Order / More Info | RNF8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|