| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATR |
|---|
| Clone | 1E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat, hamster |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity Against Recombinant Protein with GST tag on ELISA. GST tag alone is used as a negative control. It has been used for IHC-P. WB usage was reported in scientific literature. WB reported in scientific literature (PMID: 23451157). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATR Antibody (1E9) from Novus Biologicals is a mouse monoclonal antibody to ATR. This antibody reacts with human, rat, hamster. The ATR Antibody (1E9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | ATR (NP_001175, 2545 a.a. - 2644 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM |
|---|
| Other Names | ataxia telangiectasia and Rad3 related, Ataxia telangiectasia and Rad3-related protein, EC 2.7.11.1, FRAP-related protein 1, FRP1FRAP-related protein-1, MEC1, protein kinase ATR, Rad3 related protein, SCKL1, SCKLMEC1, mitosis entry checkpoint 1, homolog, serine/threonine-protein kinase ATR |
|---|
| Gene, Accession # | ATR, Gene ID: 545, Accession: NP_001175, SwissProt: NP_001175 |
|---|
| Catalog # | H00000545-M03 |
|---|
| Price | |
|---|
| Order / More Info | ATR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23451157, 25111287, 25468710, 29396668, 30746633 |
|---|
| 产品资料 |
|
|