| 产品详情 |
| Edit |   |
| Antigenic Specificity | LCLAT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LCLAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LCLAT1. This antibody reacts with human. The LCLAT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LCLAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKR |
| Other Names | 1-acylglycerol-3-phosphate O-acyltransferase 8, 1-AGPAT 8, Acyl-CoA:lysocardiolipin acyltransferase 1, AGPAT8lysocardiolipin acyltransferase, ALCAT11AGPAT8, EC 2.3.1.-, EC 2.3.1.51, FLJ37965, HSRG1849, LYCAT, lysocardiolipin acyltransferase 1, UNQ1849,1-AGP acyltransferase 8 |
| Gene, Accession # | LCLAT1, Gene ID: 253558 |
| Catalog # | NBP1-89204 |
| Price | |
| Order / More Info | LCLAT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|