| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMFR/gp78 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AMFR/gp78 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMFR/gp78. This antibody reacts with human. The AMFR/gp78 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AMFR/gp78 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVP |
|---|
| Other Names | AMF receptor, AMF receptor, isoform 1, AMF receptor, isoform 2, autocrine motility factor receptor, Autocrine motility factor receptor, isoform 2, gp78, RING finger protein 45, RNF45EC 6.3.2.- |
|---|
| Gene, Accession # | AMFR, Gene ID: 267, Accession: Q9UKV5, SwissProt: Q9UKV5 |
|---|
| Catalog # | NBP2-33917 |
|---|
| Price | |
|---|
| Order / More Info | AMFR/gp78 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|