| Edit |   |
|---|
| Antigenic Specificity | LETMD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 59%, rat 66%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human LETMD1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG |
|---|
| Other Names | LETM1 domain containing 1, HCCR1 |
|---|
| Gene, Accession # | Gene ID: 25875, UniProt: Q6P1Q0, ENSG00000050426 |
|---|
| Catalog # | HPA074361 |
|---|
| Price | |
|---|
| Order / More Info | LETMD1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|