| Edit |   |
|---|
| Antigenic Specificity | RAD17 Homolog (S. Pombe) (RAD17) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. |
|---|
| Immunogen | RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF |
|---|
| Other Names | zgc:91969|RAD17|K2A18.21|K2A18_21|RADIATION SENSITIVE 17|CCYC|HRAD17|R24L|RAD17SP|RAD24|9430035O09Rik|MmRad24 |
|---|
| Gene, Accession # | Gene ID: 5884 |
|---|
| Catalog # | ABIN631819 |
|---|
| Price | |
|---|
| Order / More Info | RAD17 Homolog (S. Pombe) (RAD17) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|