| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADI1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADI1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADI1. This antibody reacts with human. The ADI1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ADI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIK |
|---|
| Other Names | 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, Acireductone dioxygenase (Ni(2+)-requiring), acireductone dioxygenase 1, APL1, ARDsubmergence induced protein 2, EC 1.13.11.53, FLJ10913, HMFT1638, membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1, Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, MTCBP1, MTCBP-1, Ni-ARD, SIPLMT1-MMP cytoplasmic tail-binding protein-1, Submergence-induced protein 2 homolog |
|---|
| Gene, Accession # | ADI1, Gene ID: 55256, Accession: Q9BV57, SwissProt: Q9BV57 |
|---|
| Catalog # | NBP1-89037 |
|---|
| Price | |
|---|
| Order / More Info | ADI1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|