| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX18. This antibody reacts with human. The DDX18 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Specificity of human DDX18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSES |
|---|
| Other Names | DEAD (Asp-Glu-Ala-Asp) box polypeptide 18, DEAD box protein 18, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated), EC 3.6.1, EC 3.6.4.13, FLJ33908, MrDbATP-dependent RNA helicase DDX18, Myc-regulated DEAD box protein |
|---|
| Gene, Accession # | DDX18, Gene ID: 8886 |
|---|
| Catalog # | NBP2-58939 |
|---|
| Price | |
|---|
| Order / More Info | DDX18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|