| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX21 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, In vitro assay. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In vivo assay was reported in scientific literature. Use in chromatin immunoprecipitation reported in scientific literature (PMID 25470060) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX21 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX21. This antibody reacts with human. The DDX21 Antibody has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, In vitro assay. Specificity of human DDX21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV |
|---|
| Other Names | DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, DKFZp686F21172, EC 3.6.1, EC 3.6.4.13, Gu protein, GUA, gu-alpha, GURDB, nucleolar RNA helicase 2, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu, RH-II/GU, RH-II/GuA, RNA helicase II/Gu alpha |
|---|
| Gene, Accession # | DDX21, Gene ID: 9188 |
|---|
| Catalog # | NBP1-83310 |
|---|
| Price | |
|---|
| Order / More Info | DDX21 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19729515, 25470060, 29364875 |
|---|
| 产品资料 |
|
|