| Edit |   |
|---|
| Antigenic Specificity | GLYATL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GLYATL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLYATL3. This antibody reacts with human. The GLYATL3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human C6orf140. Peptide sequence NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ. |
|---|
| Other Names | glycine-N-acyltransferase-like 3 |
|---|
| Gene, Accession # | GLYATL3, Gene ID: 389396, Accession: XP_371825, SwissProt: XP_371825 |
|---|
| Catalog # | NBP1-79314-20ul |
|---|
| Price | |
|---|
| Order / More Info | GLYATL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|