| Edit |   |
|---|
| Antigenic Specificity | KIF12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIF12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF12. This antibody reacts with human. The KIF12 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIF12(kinesin family member 12) The peptide sequence was selected from the N terminal of KIF12. Peptide sequence SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH. |
|---|
| Other Names | kinesin family member 12, kinesin-like protein KIF12, RP11-56P10.3 |
|---|
| Gene, Accession # | KIF12, Gene ID: 113220, Accession: B1ALC3, SwissProt: B1ALC3 |
|---|
| Catalog # | NBP1-58181-20ul |
|---|
| Price | |
|---|
| Order / More Info | KIF12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|