| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KIF15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIF15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF15. This antibody reacts with human. The KIF15 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KIF15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD |
|---|
| Other Names | FLJ25667, HKLP2, kinesin family member 15, kinesin-like 7, Kinesin-like protein 2, Kinesin-like protein 7, kinesin-like protein KIF15, KLP2, KNSL7, NY-BR-62, Serologically defined breast cancer antigen NY-BR-62 |
|---|
| Gene, Accession # | KIF15, Gene ID: 56992, Accession: Q9NS87, SwissProt: Q9NS87 |
|---|
| Catalog # | NBP1-83252 |
|---|
| Price | |
|---|
| Order / More Info | KIF15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|