| Edit |   |
| Antigenic Specificity | KIF19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KIF19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF19. This antibody reacts with human. The KIF19 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FLJ37300 The peptide sequence was selected from the N terminal of FLJ37300. Peptide sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE. |
| Other Names | FLJ37300, KIF19A, kinesin family member 19, kinesin-like protein KIF19 |
| Gene, Accession # | KIF19, Gene ID: 124602, Accession: Q8N1X8, SwissProt: Q8N1X8 |
| Catalog # | NBP1-58168-20ul |
| Price | |
| Order / More Info | KIF19 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |