| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KIF22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIF22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIF22. This antibody reacts with human. The KIF22 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KIF22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG |
|---|
| Other Names | Kid, KIDA-328A3.2, kinesin family member 22, kinesin-like 4, Kinesin-like DNA-binding protein, Kinesin-like protein 4, kinesin-like protein KIF22, KNSL4kinesin-like DNA-binding protein pseudogene, OBP, OBP-1, OBP-2, origin of plasmid DNA replication-binding protein, oriP binding protein |
|---|
| Gene, Accession # | KIF22, Gene ID: 3835 |
|---|
| Catalog # | NBP1-82876 |
|---|
| Price | |
|---|
| Order / More Info | KIF22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|