| Edit |   |
|---|
| Antigenic Specificity | RAB39, Member RAS Oncogene Family (RAB39) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RAB39 may be involved in vesicular trafficking. |
|---|
| Immunogen | RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF |
|---|
| Other Names | RAB39|RAH|C230094F14Rik|Rab39a|Rab39 |
|---|
| Gene, Accession # | Gene ID: 83871 |
|---|
| Catalog # | ABIN633072 |
|---|
| Price | |
|---|
| Order / More Info | RAB39, Member RAS Oncogene Family (RAB39) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|