| Edit |   |
|---|
| Antigenic Specificity | Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. |
|---|
| Immunogen | KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL |
|---|
| Other Names | Klrc2|Nkg2e|KLRC2|NKG2-C|NKG2-E|NKG2E |
|---|
| Gene, Accession # | Gene ID: 3823 |
|---|
| Catalog # | ABIN635416 |
|---|
| Price | |
|---|
| Order / More Info | Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|