| Edit |   |
|---|
| Antigenic Specificity | Left-Right Determination Factor 1 (LEFTY1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. |
|---|
| Immunogen | LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE |
|---|
| Other Names | atv|cb73|antivin|ik:tdsubc_2b12|xx:tdsubc_2b12|LEFTY1|AI450052|Ebaf|Leftb|Stra3|Tgfb4|lefty|lefty-1|RGD1561867|LEFTB|LEFTYB |
|---|
| Gene, Accession # | Gene ID: 10637 |
|---|
| Catalog # | ABIN634795 |
|---|
| Price | |
|---|
| Order / More Info | Left-Right Determination Factor 1 (LEFTY1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|