| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Rad51 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Rad51 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rad51. This antibody reacts with human. The Rad51 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Rad51 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKA |
|---|
| Other Names | BRCC5, HRAD51, HsRAD51, HsT16930, RAD51 (S. cerevisiae) homolog (E coli RecA homolog), RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae), RAD51 homolog A, RAD51ABRCA1/BRCA2-containing complex, subunit 5, RecA, E. coli, homolog of, RECADNA repair protein RAD51 homolog 1, RecA-like protein, recombination protein A |
|---|
| Gene, Accession # | RAD51, Gene ID: 5888 |
|---|
| Catalog # | NBP2-32622 |
|---|
| Price | |
|---|
| Order / More Info | Rad51 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25510262, 28033363, 29029393 |
|---|
| 产品资料 |
|
|