| 产品详情 |
| Edit |   |
| Antigenic Specificity | DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. |
| Immunogen | DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV |
| Other Names | fa91b12|zgc:55590|wu:fa91b12|dbp2|ddx16|pro2014|prp2|prp8|prpf2|DHX16|DKFZp459L1130|DBP2|DDX16|PRO2014|PRP8|PRPF2|Prp2|2410006N22Rik|Ddx16|mKIAA0577|Dbp2 |
| Gene, Accession # | Gene ID: 8449 |
| Catalog # | ABIN634220 |
| Price | |
| Order / More Info | DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 产品资料 |
|
|