| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GOLGA6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GOLGA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GOLGA6. This antibody reacts with human. The GOLGA6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GOLGA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA |
|---|
| Other Names | FLJ75859, GLPGolgin-like protein, GOLGA6Golgin linked to PML, golgi autoantigen, golgin subfamily a, 6, golgi autoantigen, golgin subfamily a, 6A, golgi autoantigen, golgin subfamily a, member 6, golgin A6 family, member A, Golgin subfamily A member 6A |
|---|
| Gene, Accession # | GOLGA6A, Gene ID: 342096 |
|---|
| Catalog # | NBP2-54716 |
|---|
| Price | |
|---|
| Order / More Info | GOLGA6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|