| Edit |   |
|---|
| Antigenic Specificity | Radial Spoke Head 10 Homolog B (Chlamydomonas) (RSPH10B) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of RSPH10B protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | RSPH10 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN |
|---|
| Other Names | RSPH10B2|RGD1311893 |
|---|
| Gene, Accession # | Gene ID: 222967 |
|---|
| Catalog # | ABIN631980 |
|---|
| Price | |
|---|
| Order / More Info | Radial Spoke Head 10 Homolog B (Chlamydomonas) (RSPH10B) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|