| Edit |   |
|---|
| Antigenic Specificity | Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RSAD2 is a potential antiviral effector. |
|---|
| Immunogen | RSAD2 antibody was raised using the N terminal of RSAD2 corresponding to a region with amino acids PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP |
|---|
| Other Names | CIG6|RSAD2|2510004L01Rik|cig33|cig5|vig1|Vig1|Best5|si:ch211-276e8.2|zgc:112342|viperin|rsad2 |
|---|
| Gene, Accession # | Gene ID: 91543,58185,65190 |
|---|
| Catalog # | ABIN630168 |
|---|
| Price | |
|---|
| Order / More Info | Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|