| Edit |   |
| Antigenic Specificity | ATP6V0E2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATP6V0E2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V0E2. This antibody reacts with human. The ATP6V0E2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ATP6V0E2(ATPase, H+ transporting V0 subunit e2) The peptide sequence was selected from the middle region of ATP6V0E2. Peptide sequence TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP. |
| Other Names | ATPase, H+ transporting V0 subunit e2, chromosome 7 open reading frame 32, H+ transporting V0 subunit E isoform 2-like (rat), Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2 |
| Gene, Accession # | ATP6V0E2, Gene ID: 155066 |
| Catalog # | NBP1-55100-20ul |
| Price | |
| Order / More Info | ATP6V0E2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |