| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1E2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1E2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1E2. This antibody reacts with human. The ATP6V1E2 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: E 2 |
|---|
| Immunogen | Synthetic peptides corresponding to ATP6V1E2(ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2) The peptide sequence was selected from the middle region of ATP6V1E2. Peptide sequence LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV |
|---|
| Other Names | ATP6E1V-ATPase subunit E 2, ATP6EL2, ATP6V1EL2, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD-like 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2, MGC9341, Vacuolar proton pump subunit E 2, vacuolar-type proton-translocating ATPase subunit E1, VMA4, V-type proton ATPase subunit E 2 |
|---|
| Gene, Accession # | ATP6V1E2, Gene ID: 90423, Accession: Q96A05, SwissProt: Q96A05 |
|---|
| Catalog # | NBP1-54601 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1E2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|