| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1B1. This antibody reacts with human. The ATP6V1B1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATP6V1B1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV |
|---|
| Other Names | ATP6B158kD subunit, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1, Endomembrane proton pump 58 kDa subunit, H+-ATPase beta 1 subunit, vacuolar proton pump 3, Vacuolar proton pump subunit B 1, vacuolar proton pump, subunit 3, VATBMGC32642, V-ATPase B1 subunit, V-ATPase subunit B 1, Vma2, V-type proton ATPase subunit B, kidney isoform |
|---|
| Gene, Accession # | ATP6V1B1, Gene ID: 525, Accession: P15313, SwissProt: P15313 |
|---|
| Catalog # | NBP2-33962 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|