| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1B1 |
|---|
| Clone | 3G11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1B1 Antibody (3G11) from Novus Biologicals is a mouse monoclonal antibody to ATP6V1B1. This antibody reacts with human. The ATP6V1B1 Antibody (3G11) has been validated for the following applications: ELISA. |
|---|
| Immunogen | ATP6V1B1 (NP_001683.2, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIVHFTLPDGTQ |
|---|
| Other Names | ATP6B158kD subunit, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1, Endomembrane proton pump 58 kDa subunit, H+-ATPase beta 1 subunit, vacuolar proton pump 3, Vacuolar proton pump subunit B 1, vacuolar proton pump, subunit 3, VATBMGC32642, V-ATPase B1 subunit, V-ATPase subunit B 1, Vma2, V-type proton ATPase subunit B, kidney isoform |
|---|
| Gene, Accession # | ATP6V1B1, Gene ID: 525, Accession: NP_001683, SwissProt: NP_001683 |
|---|
| Catalog # | H00000525-M02 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|