| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP6V1B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP6V1B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP6V1B2. This antibody reacts with human. The ATP6V1B2 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: B, brain isoform |
|---|
| Immunogen | Synthetic peptides corresponding to ATP6V1B2(ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2) The peptide sequence was selected from the N terminal of ATP6V1B2. Peptide sequence VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG |
|---|
| Other Names | 000 subunit, 56/58kD, isoform 2, ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2, Endomembrane proton pump 58 kDa subunit, H+ transporting two-sector ATPase, HO57ATP6B1B2, vacuolar H+-ATPase 56, Vacuolar proton pump subunit B 2, VATB, V-ATPase B2 subunit, V-ATPase subunit B 2, Vma2, VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2, V-type proton ATPase subunit B, brain isoform |
|---|
| Gene, Accession # | ATP6V1B2, Gene ID: 526, Accession: P21281, SwissProt: P21281 |
|---|
| Catalog # | NBP1-54759 |
|---|
| Price | |
|---|
| Order / More Info | ATP6V1B2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|