| 产品详情 |
| Edit |   |
| Antigenic Specificity | Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. |
| Immunogen | CHAF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD |
| Other Names | CHAF1B|wu:fd07c09|wu:fe36g06|wu:fv38g09|zgc:56096|CAF-1|CAF-IP60|CAF1|CAF1A|CAF1P60|MPHOSPH7|MPP7|2600017H24Rik|C76145|CAF-I p60|CAF-Ip60|caf-1|CAF-1P60 |
| Gene, Accession # | Gene ID: 8208,110749,288242 |
| Catalog # | ABIN634083 |
| Price | |
| Order / More Info | Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 产品资料 |
|
|