| Edit |   |
|---|
| Antigenic Specificity | Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication. |
|---|
| Immunogen | CDT1 antibody was raised using the C terminal of CDT1 corresponding to a region with amino acids PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ |
|---|
| Other Names | CDT1|fc37h07|im:7158083|wu:fc37h07|wu:fi38h09|xcdt1|DUP|RIS2|2610318F11Rik|AW545653|C76791|Ris2|dup|ris2 |
|---|
| Gene, Accession # | Gene ID: 81620,67177,292071 |
|---|
| Catalog # | ABIN634110 |
|---|
| Price | |
|---|
| Order / More Info | Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|