| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | alpha-Actinin 1 |
|---|
| Clone | 3F1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG3 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 100 ug |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alpha-Actinin 1 Antibody (3F1) from Novus Biologicals is a mouse monoclonal antibody to alpha-Actinin 1. This antibody reacts with human. The alpha-Actinin 1 Antibody (3F1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ACTN1 (NP_001093, 543 a.a. - 639 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA |
|---|
| Other Names | actinin 1 smooth muscle, actinin, alpha 1, alpha-actinin 1, Alpha-actinin cytoskeletal isoform, alpha-actinin-1, F-actin cross-linking protein, FLJ40884, FLJ54432, Non-muscle alpha-actinin-1 |
|---|
| Gene, Accession # | ACTN1, Gene ID: 87, Accession: NP_001093, SwissProt: NP_001093 |
|---|
| Catalog # | H00000087-M01-100ug |
|---|
| Price | |
|---|
| Order / More Info | alpha-Actinin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20156433, 23100251 |
|---|
| 产品资料 |
|
|