| Edit |   |
|---|
| Antigenic Specificity | KANK3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 45%, rat 51%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human KANK3 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK |
|---|
| Other Names | KN motif and ankyrin repeat domains 3, ANKRD47, FLJ46061 |
|---|
| Gene, Accession # | Gene ID: 256949, UniProt: Q6NY19, ENSG00000186994 |
|---|
| Catalog # | HPA051153 |
|---|
| Price | |
|---|
| Order / More Info | KANK3 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|