| Edit |   |
| Antigenic Specificity | DIS3L2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DIS3L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DIS3L2. This antibody reacts with human. The DIS3L2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DIS3L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS |
| Other Names | DIS3 mitotic control homolog (S. cerevisiae)-like 2, DIS3-like exonuclease 2, FAM6A, member A |
| Gene, Accession # | DIS3L2, Gene ID: 129563, Accession: Q8IYB7, SwissProt: Q8IYB7 |
| Catalog # | NBP2-38264 |
| Price | |
| Order / More Info | DIS3L2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |