| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Syntaxin-BP1 |
|---|
| Clone | 6D1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Syntaxin-BP1 Antibody (6D1) from Novus Biologicals is a mouse monoclonal antibody to Syntaxin-BP1. This antibody reacts with human, mouse. The Syntaxin-BP1 Antibody (6D1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | STXBP1 (NP_003156 74 a.a. - 168 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI |
|---|
| Other Names | EIEE4, FLJ37475, hUNC18, MUNC18-1, N-Sec1, NSEC1, P67, Protein unc-18 homolog 1, Protein unc-18 homolog A, RBSEC1, syntaxin binding protein 1, syntaxin-binding protein 1, Unc18-1, unc-18A, UNC18A, UNC18neuronal SEC1 |
|---|
| Gene, Accession # | STXBP1, Gene ID: 6812, Accession: NP_003156, SwissProt: NP_003156 |
|---|
| Catalog # | H00006812-M01 |
|---|
| Price | |
|---|
| Order / More Info | Syntaxin-BP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|