| Edit |   |
|---|
| Antigenic Specificity | TSPYL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSPYL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPYL4. This antibody reacts with human. The TSPYL4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TSPYL4(TSPY-like 4) The peptide sequence was selected from the middle region of TSPYL4. Peptide sequence QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE. |
|---|
| Other Names | KIAA0721dJ486I3.2, testis-specific Y-encoded-like protein 4, TSPY-like 4, TSPY-like protein 4 |
|---|
| Gene, Accession # | TSPYL4, Gene ID: 23270, Accession: Q9UJ04, SwissProt: Q9UJ04 |
|---|
| Catalog # | NBP1-56289 |
|---|
| Price | |
|---|
| Order / More Info | TSPYL4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|