| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACSL5 |
|---|
| Clone | CL0275 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACSL5 Antibody (CL0275) from Novus Biologicals is a mouse monoclonal antibody to ACSL5. This antibody reacts with human. The ACSL5 Antibody (CL0275) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ACSL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
|---|
| Other Names | ACS2, ACS5FACL5 for fatty acid coenzyme A ligase 5, acyl-CoA synthetase long-chain family member 5, EC 6.2.1, EC 6.2.1.3, FACL5fatty acid coenzyme A ligase 5, fatty-acid-Coenzyme A ligase, long-chain 5, LACS 5, Long-chain acyl-CoA synthetase 5, long-chain fatty acid coenzyme A ligase 5, long-chain-fatty-acid--CoA ligase 5 |
|---|
| Gene, Accession # | ACSL5, Gene ID: 51703 |
|---|
| Catalog # | NBP2-52899 |
|---|
| Price | |
|---|
| Order / More Info | ACSL5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|