| Edit |   |
|---|
| Antigenic Specificity | Kaptin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kaptin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kaptin. This antibody reacts with human. The Kaptin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KPTN(kaptin (actin binding protein)) The peptide sequence was selected from the N terminal of KPTN. Peptide sequence MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL. |
|---|
| Other Names | 2E4, Actin-associated protein 2E4, kaptin, kaptin (actin binding protein), kaptin (actin-binding protein) |
|---|
| Gene, Accession # | KPTN, Gene ID: 11133, Accession: Q9Y664, SwissProt: Q9Y664 |
|---|
| Catalog # | NBP1-55221-20ul |
|---|
| Price | |
|---|
| Order / More Info | Kaptin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|