| Edit |   |
|---|
| Antigenic Specificity | Kaptin (Actin Binding Protein) (KPTN) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation. |
|---|
| Immunogen | Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL |
|---|
| Other Names | 2310042D10Rik|2E4|C030013F01Rik|wu:fc13b08|wu:fc13b09|zgc:100793 |
|---|
| Gene, Accession # | Gene ID: 11133,70394,308107 |
|---|
| Catalog # | ABIN631596 |
|---|
| Price | |
|---|
| Order / More Info | Kaptin (Actin Binding Protein) (KPTN) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|