| Edit |   |
|---|
| Antigenic Specificity | glycerol-3-phosphate permease |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The glycerol-3-phosphate permease Antibody from Novus Biologicals is a rabbit polyclonal antibody to glycerol-3-phosphate permease. This antibody reacts with human. The glycerol-3-phosphate permease Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC37A1(solute carrier family 37 (glycerol-3-phosphate transporter), member 1) The peptide sequence was selected from the middle region of SLC37A1 (NP_061837). Peptide sequence LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLD |
|---|
| Other Names | FLJ22340, G-3-P permease, G-3-P transporter, G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease, glycerol-3-phosphate transporter, solute carrier family 37 (glycerol-3-phosphate transporter), member 1, Solute carrier family 37 member 1 |
|---|
| Gene, Accession # | SLC37A1, Gene ID: 54020, Accession: P57057, SwissProt: P57057 |
|---|
| Catalog # | NBP1-69300 |
|---|
| Price | |
|---|
| Order / More Info | glycerol-3-phosphate permease Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|