| Edit |   |
|---|
| Antigenic Specificity | Glycerophosphodiester Phosphodiesterase 1 (GDE1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways. |
|---|
| Immunogen | GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN |
|---|
| Other Names | zgc:56068|zgc:77135|363E6.2|MIR16|1200003M13Rik|Mir16|RGS16 |
|---|
| Gene, Accession # | Gene ID: 51573,479827,56209,60418 |
|---|
| Catalog # | ABIN636050 |
|---|
| Price | |
|---|
| Order / More Info | Glycerophosphodiester Phosphodiesterase 1 (GDE1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|