| Edit |   |
| Antigenic Specificity | PTTG1IP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 87%, rat 90%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human PTTG1IP polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA |
| Other Names | pituitary tumor-transforming 1 interacting protein, C21orf1, C21orf3, PBF |
| Gene, Accession # | Gene ID: 754, UniProt: P53801, ENSG00000183255 |
| Catalog # | HPA061827 |
| Price | |
| Order / More Info | PTTG1IP Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |