| Edit |   |
|---|
| Antigenic Specificity | PTTG1IP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTTG1IP Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTTG1IP. This antibody reacts with human. The PTTG1IP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PTTG1IP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA |
|---|
| Other Names | C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein, PBFPTTG-binding factor, pituitary tumor-transforming 1 interacting protein, Pituitary tumor-transforming gene protein-binding factor |
|---|
| Gene, Accession # | PTTG1IP, Gene ID: 754 |
|---|
| Catalog # | NBP2-57370 |
|---|
| Price | |
|---|
| Order / More Info | PTTG1IP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|