| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUPT16H |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUPT16H Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUPT16H. This antibody reacts with human. The SUPT16H Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, SUPT16H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSY |
|---|
| Other Names | CDC68, Chromatin-specific transcription elongation factor 140 kDa subunit, facilitates chromatin remodeling 140 kDa subunit, Facilitates chromatin transcription complex subunit SPT16, FACT 140 kDa subunit, FACT complex subunit SPT16, FACT140, FACTp140, FACTP140FACT, FLJ10857, FLJ14010, FLJ34357, hSPT16, SPT16/CDC68, suppressor of Ty (S.cerevisiae) 16 homolog, suppressor of Ty 16 homolog (S. cerevisiae) |
|---|
| Gene, Accession # | SUPT16H, Gene ID: 11198, Accession: Q9Y5B9, SwissProt: Q9Y5B9 |
|---|
| Catalog # | NBP2-38607 |
|---|
| Price | |
|---|
| Order / More Info | SUPT16H Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|