| Edit |   |
|---|
| Antigenic Specificity | BAD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 86%, rat 88%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human BAD polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR |
|---|
| Other Names | BCL2-associated agonist of cell death, BBC2, BCL2L8 |
|---|
| Gene, Accession # | Gene ID: 572, UniProt: Q92934, ENSG00000002330 |
|---|
| Catalog # | HPA062105 |
|---|
| Price | |
|---|
| Order / More Info | BAD Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|