| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Bad |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Bad Antibody from Novus Biologicals is a rabbit polyclonal antibody to Bad. This antibody reacts with human. The Bad Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Bad antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR |
|---|
| Other Names | BBC2, BBC6, bcl2 antagonist of cell death, BCL2-antagonist of cell death protein, BCL2-associated agonist of cell death, Bcl-2-binding component 6, BCL2-binding component 6, BCL2-binding protein, Bcl2-L-8, BCL2L8bcl2-L-8, Bcl-2-like protein 8, BCL-X/BCL-2 binding protein, Bcl-XL/Bcl-2-associated death promoter |
|---|
| Gene, Accession # | BAD, Gene ID: 572, Accession: Q92934, SwissProt: Q92934 |
|---|
| Catalog # | NBP2-38947 |
|---|
| Price | |
|---|
| Order / More Info | Bad Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|