| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CISD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CISD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CISD2. This antibody reacts with human. The CISD2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CISD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV |
|---|
| Other Names | CDGSH iron sulfur domain 2, CDGSH iron-sulfur domain-containing protein 2, CDGSH2, Endoplasmic reticulum intermembrane small protein, ERISWFS2, Miner1Wolfram syndrome 2, mitoNEET related 1, MitoNEET-related 1 protein, NAF-1, Nutrient-deprivation autophagy factor-1, ZCD2CDGSH iron sulfur domain-containing protein 2, zinc finger, CDGSH-type domain 2 |
|---|
| Gene, Accession # | CISD2, Gene ID: 493856 |
|---|
| Catalog # | NBP1-84809 |
|---|
| Price | |
|---|
| Order / More Info | CISD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|