| Edit |   |
|---|
| Antigenic Specificity | Death-Associated Protein Kinase 1 (DAPK1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160 kDa calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen |
|---|
| Immunogen | DAPK1 antibody was raised using the N terminal of DAPK1 corresponding to a region with amino acids MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK |
|---|
| Other Names | DAPK1|MGC81366|si:ch211-66i11.1|wu:fj09c03|dapk|MGC83745|2310039H24Rik|2810425C21Rik|AI642003|D13Ucla1|DAP-Kinase|DAPK |
|---|
| Gene, Accession # | Gene ID: 1612 |
|---|
| Catalog # | ABIN634506 |
|---|
| Price | |
|---|
| Order / More Info | Death-Associated Protein Kinase 1 (DAPK1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|