| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUR1. This antibody reacts with human. The SUR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ABCC8(ATP-binding cassette, sub-family C (CFTR/MRP), member 8) The peptide sequence was selected from the N terminal of ABCC8. Peptide sequence PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW. |
|---|
| Other Names | ABC36, ATP-binding cassette, sub-family C (CFTR/MRP), member 8, HHF1Sulfonylurea receptor 1, HI, PHHIHRINS, sulfonylurea receptor (hyperinsulinemia), SUR1MRP8, SURATP-binding cassette transporter sub-family C member 8, TNDM2ATP-binding cassette sub-family C member 8 |
|---|
| Gene, Accession # | ABCC8, Gene ID: 6833, Accession: Q09428, SwissProt: Q09428 |
|---|
| Catalog # | NBP1-59778 |
|---|
| Price | |
|---|
| Order / More Info | SUR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29849783 |
|---|
| 产品资料 |
|
|