| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SDHD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SDHD Antibody from Novus Biologicals is a rabbit polyclonal antibody to SDHD. This antibody reacts with human. The SDHD Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SDHD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW |
|---|
| Other Names | CBT1, CII-4, CybS, PGL, PGL1, QPs3, SDH4, succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, Succinate dehydrogenase complex subunit D, succinate dehydrogenase complex, subunit D, integral membrane protein, succinate dehydrogenase ubiquinone cytochrome B small subunit, Succinate-ubiquinone oxidoreductase cytochrome b small subunit, Succinate-ubiquinone reductase membrane anchor subunit |
|---|
| Gene, Accession # | SDHD, Gene ID: 6392, Accession: O14521, SwissProt: O14521 |
|---|
| Catalog # | NBP1-92372 |
|---|
| Price | |
|---|
| Order / More Info | SDHD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25328978 |
|---|
| 产品资料 |
|
|